PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400009657
Common NameLOC102583487
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bZIP
Protein Properties Length: 205aa    MW: 23576.4 Da    PI: 7.7663
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400009657genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.64.9e-1286139558
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                           ++ +r+++NRe+ArrsR RK+  +e+L++ +  L+ eN++L ++++  + +++ 
  PGSC0003DMP400009657  86 RKRKRMISNRESARRSRMRKQTHLENLRNQSNRLKLENRDLTNRVQLVTGHYQL 139
                           5789****************************************9998888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-1076134No hitNo description
SMARTSM003381.7E-1182146IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9184134IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.94E-1186137No hitNo description
PfamPF001701.4E-986138IPR004827Basic-leucine zipper domain
CDDcd147021.65E-1887138No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MLSTILSSDG LFPNTFPSLY DDFTQWDYIE PTSIFPEPGV ESVFSPMQSP TPEPVISHDS  60
GSGSDKSKPD SPNDSPNPGS DDLAERKRKR MISNRESARR SRMRKQTHLE NLRNQSNRLK  120
LENRDLTNRV QLVTGHYQLV ERNNEMLRAE SILLRQRLEG IHDILITRQL QQQLYNSAFA  180
IRPCNNLYVE QRPHIINQPI INHQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362088.11e-149PREDICTED: bZIP transcription factor 53-like
TrEMBLM1A3K41e-149M1A3K4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000139721e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.21e-22basic leucine-zipper 6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]